Products

IL-36 alpha (Interleukin-36 alpha), Mouse

Interleukin-36α (IL-36 alpha ) binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. IL-36 eems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1, and the production of proinflammatory cytokines such as TNF-alpha, IL-8 and IL-6. In cultured monocytes upregulates expression of IL-1A, IL-1B and IL-6. In myeloid dendritic cells involved in cell maturation by upregulating surface expression of CD83, CD86 and HLA-DR. In monocyte-derived dendritic cells facilitates dendritic cell maturation and drives T-cell proliferation. IL-36 may also play a role in proinflammatory effects in the lung.
No. Size Price Qty Status
C02037-20UG 20 ug $268.00 Inquiry
C02037-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEG
NIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH with polyhistidine tag at the C-terminus

UnitProt ID:
Q9JLA2
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 105 IU/mg.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for IL-36 alpha (Interleukin-36 alpha), Mouse

Average Rating: 0 (0 Reviews )